bkamryn28 bkamryn28

10-11-2020
Mathematics

contestada

Can the ordered pair (1,12) be found on the graph of 35 miles per hour?

A. Yes
B. No

Respuesta :

chicotahwhited chicotahwhited

10-11-2020

Answer:

A. Yes

Step-by-step explanation:

Answer Link

kitten3212397 kitten3212397

10-11-2020

Answer:

ya

Step-by-step explanation:

35 is big

Answer Link

Otras preguntas

Richard states that when he was in middle school, his peers thought that being a black man meant being ________?

What does stage 2 in a dental infection consist of? a) Abscess formation b) Pulpitis c) Gingivitis d) Periodontitis

Find the answer to the equation (2^2)^6 times 3^3

Contemporary intelligence researchers like Howard Gardner and Robert Sternberg complain that schools focus too much on _____.a) Emotional intelligenceb) Standar

suppose that 2000 is loaned at a rate of 15.5 compounded annually. assuming that no payments are made, find the amount owed after 4 years

In a 1-2 page typed response (standard font and margins with sources cited) , describe some of the historical and political reasons for the difference in:

Rank the clients in terms of their anticipated risk tolerance from highest to lowest.Client A - high income, security of employment.Client B - self-employed ent

A personal blank is an individual guid to help you improve your overall health and well-being

An imposed law on drivers under the age of 21 who have a BA of 0.01 percent or more is called:

For the peptide YALGIIQAQPDKSESELVSQIIEELIKKEK, predict the electrospray ionization mass spectrum. Assume that the molecular weight of the uncharged peptide is