dadhamilton55
dadhamilton55 dadhamilton55
  • 06-10-2020
  • Mathematics
contestada

Help me please.......

Help me please class=

Respuesta :

leo3585
leo3585 leo3585
  • 06-10-2020

Answer:

90 . this can be easily answered as all the angle of points are given in question

Step-by-step explanation:

90 degree angle

Answer Link

Otras preguntas

How do you simplify this expression?
Definition of periodic trends
Urban Drapers Inc., a drapery company, has been successfully doing business for the past 15 years. It went public eight years ago and has been paying out a cons
The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the protein
Exercise 6-8 Petty cash fund with a shortage LO P2 Waupaca Company establishes a $330 petty cash fund on September 9. On September 30, the fund shows $46 in cas
I have a test in biology 9th grade, it’s about organ system and how the orange work together. How do I explain ?
Can anybody help me please with question 1 please and thank you .I would really appreciate it so much. Please
Pre-reading question: What do you think of when you hear the word "enlightenment"? What does it mean to you?
There's no difference between listening and speaking. O True O False
Both farms and factories increased their production capacity through more efficient machinery​