betagaisttheoods
betagaisttheoods betagaisttheoods
  • 09-06-2021
  • Health
contestada

А -BLANK- means a batter was able to run to second base on a hit ball.

Double
Catch
Error
Assist

Fill in the blank :)

Respuesta :

Snatchedsouls
Snatchedsouls Snatchedsouls
  • 09-06-2021
The answer you are looking for is “double”
Answer Link
astruio
astruio astruio
  • 09-06-2021
catch maybe i’m not sure ?
Answer Link

Otras preguntas

If the function rule for a sequence is f(n)= 600/n, state the first four terms (for n=1, n=2, n=3, and n=4). Blank 1: Blank 2: Blank 3: Blank 4:
Pleasedjhdndndndmwmkqkskdnfndmdmmdmdmdmdmdmf
csch (-1) what dose it equal??
Write a conjecture 1,4,9, 16
Classify each figure as a line, ray, or line segment. Then, show how to write it.
how to punctuate: Abby’s list read first do your math then you may play
CRITERIA C and D – Developing an Algorithm Your goal is to show that representing and simplifying quantities in different forms can help explore remarkable disc
a 1-mm-thick copper plate (k 5 386 w/m·k) is sand- wiched between two 5-mm-thick epoxy boards (k 5 0.26 w/m·k) that are 15 cm 3 20 cm in size. if the thermal co
what were three roots of medieval culture in western Europe?
Which fraction has a terminating decimal as its decimal expansion